PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 357aa    MW: 39805.1 Da    PI: 6.3766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011520.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.2e-091861447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     WT+eEd +++    ++G+ +W++++++ g +R++k+ ++rw ++
      Pbr011520.1 18 WTAEEDAKILAHESKHGTSNWTSVPKKPGITRCGKSSRLRWPNH 61
                     *****************************99**********776 PP

2Myb_DNA-binding452.5e-1470111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ E+el+v++++  G++ W +Ia+ ++ gRt++++k++w++
      Pbr011520.1  70 SFTPHEEELIVRLHATIGSR-WPAIAQQLP-GRTDNDVKNYWNT 111
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.3351061IPR017930Myb domain
SuperFamilySSF466893.67E-2314109IPR009057Homeodomain-like
SMARTSM007173.2E-51464IPR001005SANT/Myb domain
CDDcd001674.66E-61858No hitNo description
PfamPF002495.4E-81861IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-161869IPR009057Homeodomain-like
PROSITE profilePS5129420.65463117IPR017930Myb domain
SMARTSM007172.8E-1367115IPR001005SANT/Myb domain
CDDcd001672.88E-1070113No hitNo description
PfamPF002491.4E-1270111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MVRPACCDKL HVKRDTLWTA EEDAKILAHE SKHGTSNWTS VPKKPGITRC GKSSRLRWPN  60
HFKPNLKHES FTPHEEELIV RLHATIGSRW PAIAQQLPGR TDNDVKNYWN TKLKKKLSEM  120
GIDPVTHKPF SQVLADYGNI GGVSKVGMRI GIGSLNKDLK NAMLMKPAEP YLLPAQGFSN  180
INSHLMPITM IPTKAEPILD SFLGHNQPSS QPPDLLTQLQ AIKLVTEASK SMEFQSSAPY  240
FYSHEGTLSS PSSTSSSAAQ EQATLQTFSW SDFLLEDAFM PIGDTQEHKN KAEYSSKNIA  300
QVAVQQSQID MDYAISSNEI EATSPACDSS FVEAMVSREN EMFLEFPELL EEPFYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-251811710108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009369384.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM5WT280.0M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-60MYB family protein